PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g017300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-PHD
Protein Properties Length: 923aa    MW: 104017 Da    PI: 4.6861
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g017300.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-10544588953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     k  +e L  +F++n  ps++ r +L+k+l+L+ ++V+ WF+N R+
  Csa12g017300.1 544 KAAVEKLRIAFAENELPSKDVRDRLSKELSLDPEKVSKWFKNTRY 588
                     567899999**********************************97 PP

2PHD41.14e-14274329151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C++  +  +++++lCd +C+++fH+kCl+++le+e++p g   w+C+ C++k
  Csa12g017300.1 274 FCAECNSreAFPDNDIILCDgTCNRAFHQKCLDPPLETESIPPGdqGWFCKLCDCK 329
                     6999***55455********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.5E-14266331IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.104.1E-12270329IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.994272329IPR019787Zinc finger, PHD-finger
PfamPF006282.8E-11274329IPR019787Zinc finger, PHD-finger
CDDcd155044.95E-31274326No hitNo description
SMARTSM002497.9E-10274327IPR001965Zinc finger, PHD-type
PROSITE patternPS013590275326IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.608.8E-12523587IPR009057Homeodomain-like
SuperFamilySSF466895.99E-10532597IPR009057Homeodomain-like
PROSITE profilePS5007112.827533593IPR001356Homeobox domain
SMARTSM003891.5E-11535597IPR001356Homeobox domain
CDDcd000866.50E-9536597No hitNo description
PfamPF000461.5E-7544588IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    Send to blast
MKINKSCCEQ ISITIAKVKY QRRGPESDVN TRPLKAPFQL AAGDSILKII VSPHYPCRKD  60
LHFGFFLPQF PHTHLLTLFQ ESETKGRIRR ETEKACVSVE RIGSTLLSSL AKKGKETSNK  120
RNPKPNKRKT EEEICSKSRN KKCTRGRVHC EEENEEEEEE KGKRTRKRKS KRQQKDNKVE  180
VDDSLRLQRR TRYLLIKMKM QQNLIDAYAT EGWKGQSREK IRPDKELERA RKEILNCKLG  240
LRDAIRQLDL LSSVGSMEDK VIALDGSIHH DHIFCAECNS REAFPDNDII LCDGTCNRAF  300
HQKCLDPPLE TESIPPGDQG WFCKLCDCKM EIIDTMNAQI GTHFPADSNW QDIFKEEASL  360
PIGSEATVNN EADWPSDDSK DDDYDPEMRE KGGGSSSNVS GGGGGGGDND GESSSTSLSS  420
DGVALSTGSW EGHGFNNMVE QCETSNEEAV CGPRQRRTVD YTKLYYEMFG KDAVLQEQGS  480
EDEDWGPNDR RKRRKESDVT SELVNMCESS KKDQDAVQIP EQRKRDSVSV ENKGGRRPMF  540
RLPKAAVEKL RIAFAENELP SKDVRDRLSK ELSLDPEKVS KWFKNTRYMA LRNRKMESEK  600
QPEHSKTVSG RDSEPEAVMK NNTDTKQAQN TLDETVPPGF NDSATNQKTI SPCNNNQEVT  660
EDLKTVSGGD SGDSGPEEVM ENDTNEVQDS LDETFPPGFN DLATNQKIYS PCNNSPEIPE  720
DLKTVSGGDS EPEAVMENDT NEVQDSLDET FPPGFNDLAA NQNILSPCNN NQEETQQANV  780
SFPAPTDEIQ QYLEQNDSSF ALVPHEELSS EMSLKTAVEE KETESKTTEE PHDEELSSGM  840
SLKTAEEEEE TESKITEEEE YEAVMEMLCR TKNKLLDVSQ RLERFKTPKG RKKLGRCSSS  900
LSEEDSVVYV PIVEVMEKKE NN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164169TRKRKS
2490495RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHPRHA0.0L21991.1 Arabidopsis thaliana homeodomain protein (PRHA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447786.10.0PREDICTED: pathogenesis-related homeodomain protein-like isoform X1
SwissprotP487850.0PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLR0F3V50.0R0F3V5_9BRAS; Uncharacterized protein
STRINGAT4G29940.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.10.0pathogenesis related homeodomain protein A